Protein coding transcript 265078

• Transcript: Ll_transcript_48734
• CDS coordinates: 3-383 (-)
• Peptide sequence: MNISCPPLTTIDRFLWNQQAHNIVAKNNNASVSAEEFSAFSTFGGSNHRFQWQYSQEASFVYGHLGNEEALNWTNMHQTPKKQVKNVKVKGRRTKKESNSVSLIKGQWSDEEDRKLIKFVKKYGERK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_48734

• Blastp: Transcription factor MYB119 from Arabidopsis with 30.88% of identity
• Blastx: Transcription factor MYB119 from Arabidopsis with 28.68% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT5G58850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003615607.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;