Transcript | Ll_transcript_520977 |
---|---|
CDS coordinates | 170-730 (+) |
Peptide sequence | MWIRLYTFTLFHCPQSAPYPVGIFCIGRFFTLEDCMHMSIYVELTEFQASKVALCTSGTVAVELQLARLPCVVAYRANILTEWFIQYKAKIKYISLPNILLDSDIIPEALFRSCTPENLALLLKDLITDSSCREEQITAAEKFVKLLLPSEGIKHNLLQQNVMTTYPQFNPSVVAALTILNHGNSL* |
ORF Type | complete |
Blastp | Probable lipid-A-disaccharide synthase, mitochondrial from Arabidopsis with 54.79% of identity |
---|---|
Blastx | Probable lipid-A-disaccharide synthase, mitochondrial from Arabidopsis with 54.79% of identity |
Eggnog | Condensation of UDP-2,3-diacylglucosamine and 2,3- diacylglucosamine-1-phosphate to form lipid A disaccharide, a precursor of lipid A, a phosphorylated glycolipid that anchors the lipopolysaccharide to the outer membrane of the cell (By similarity)(COG0763) |
Kegg | Link to kegg annotations (AT2G04560) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462594.1) |
Pfam | Lipid-A-disaccharide synthetase (PF02684.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer