Protein coding transcript 26520

• Transcript: Ll_transcript_520982
• CDS coordinates: 428-916 (+)
• Peptide sequence: MSDLPWALARPSSKPTSASDLRRNVNRKYGVDEINEPPSRIPGIRSLLPLPGGDLLTGGTDLKIRRWDHSSPDRSYCICGPNLKGVGNNDFYESKSSFGVQVVQETKRRPLTAKLTGKAILAAAATDSAGCHRDSIVSLASVKLNQRLLLSSGRDGAIKVWK*
• ORF Type: complete

Annotations of Ll_transcript_520982

• Blastp: Phosphoinositide 3-kinase regulatory subunit 4 from Mus with 34.86% of identity
• Blastx: -
• Eggnog: phosphoinositide-3-kinase, regulatory subunit 4(ENOG410XPDN)
• Kegg: Link to kegg annotations (75669)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458006.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;