Protein coding transcript 265321

• Transcript: Ll_transcript_210125
• CDS coordinates: 1-369 (-)
• Peptide sequence: IKRVCPAEKEAIIWYDLCMLRYSNQSLNKIVPGVDLSDSKSIALAELNKFNELLSGLLNALATKAANSMIDKKFATGEVNFTRTMKLYGLVECTPDFSLFECNMCLRSAIASVPNCCDGKQGA
• ORF Type: internal

Annotations of Ll_transcript_210125

• Blastp: Cysteine-rich receptor-like protein kinase 25 from Arabidopsis with 47.54% of identity
• Blastx: Cysteine-rich receptor-like protein kinase 25 from Arabidopsis with 47.54% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G05200)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452501.1)
• Pfam: Salt stress response/antifungal (PF01657.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;