Transcript | Ll_transcript_210125 |
---|---|
CDS coordinates | 1-369 (-) |
Peptide sequence | IKRVCPAEKEAIIWYDLCMLRYSNQSLNKIVPGVDLSDSKSIALAELNKFNELLSGLLNALATKAANSMIDKKFATGEVNFTRTMKLYGLVECTPDFSLFECNMCLRSAIASVPNCCDGKQGA |
ORF Type | internal |
Blastp | Cysteine-rich receptor-like protein kinase 25 from Arabidopsis with 47.54% of identity |
---|---|
Blastx | Cysteine-rich receptor-like protein kinase 25 from Arabidopsis with 47.54% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT4G05200) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452501.1) |
Pfam | Salt stress response/antifungal (PF01657.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer