| Transcript | Ll_transcript_4308 |
|---|---|
| CDS coordinates | 1-333 (-) |
| Peptide sequence | MKNQILIIIFTLFIESTQDFPAFITSVVNQTTTNLIRIKKLGVKKIVVSGLQPLGCVPQVTVSSTFQRCNSTFNNLVVLHNNLLNQSVTKLNQESKNPILILDLYDSFMSI |
| ORF Type | 3prime_partial |
| Blastp | GDSL esterase/lipase At5g03610 from Arabidopsis with 58.33% of identity |
|---|---|
| Blastx | GDSL esterase/lipase At5g03610 from Arabidopsis with 59.57% of identity |
| Eggnog | GDSL esterase lipase(ENOG4111T31) |
| Kegg | Link to kegg annotations (AT5G03610) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019442980.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer