Protein coding transcript 265527

• Transcript: Ll_transcript_45553
• CDS coordinates: 3-329 (-)
• Peptide sequence: FVSSPEVGFLKGINKKVNRETKVIFQLLNANDVEPTTNKTYGTIVKDLTTIKSFASGITVPKEYIWPVKPDKYLGPRTTLVVDAHKQGLEVYAYGFANDFFSSYNYSYD
• ORF Type: internal

Annotations of Ll_transcript_45553

• Blastp: Glycerophosphodiester phosphodiesterase GDPDL7 from Arabidopsis with 59.63% of identity
• Blastx: Glycerophosphodiester phosphodiesterase GDPDL7 from Arabidopsis with 59.63% of identity
• Eggnog: glycerophosphoryl diester phosphodiesterase(COG0584)
• Kegg: Link to kegg annotations (AT5G58170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415134.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;