| Transcript | Ll_transcript_233351 |
|---|---|
| CDS coordinates | 2-340 (-) |
| Peptide sequence | MRNVPVGAGRRKNKNSASHYPHITISEALEAARIDAPNGNHHPMLKSNGRVLSFGLDHAPICDSMASVLNLGDKKVLNCATRNEFHGFEDRRFPVPCKSGENSTDSIGCSNTS |
| ORF Type | 3prime_partial |
| Blastp | Cyclic dof factor 3 from Arabidopsis with 48.7% of identity |
|---|---|
| Blastx | Cyclic dof factor 3 from Arabidopsis with 48.7% of identity |
| Eggnog | zinc finger protein(ENOG410YN7N) |
| Kegg | Link to kegg annotations (AT3G47500) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019438320.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer