Protein coding transcript 265610

• Transcript: Ll_transcript_270079
• CDS coordinates: 2-445 (+)
• Peptide sequence: LKAVVAQFDAGELITQRENVSRKVSETLIERAGQFGVVLDDISITHLTFGKEFTQAVELKQVAQQDAERARFLVEKAEQQKQASIISAQGDSEAASMLAKSFGDAGEGLVELRRIEAAEDIAYQLSRSRQVSYFPPGQNILLNLPAQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_270079

• Blastp: Protein l(2)37Cc from Sophophora with 78.77% of identity
• Blastx: Protein l(2)37Cc from Sophophora with 78.77% of identity
• Eggnog: Band 7 protein(COG0330)
• Kegg: Link to kegg annotations (Dmel_CG10691)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413865.1)
• Pfam: SPFH domain / Band 7 family (PF01145.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;