Protein coding transcript 265731

• Transcript: Ll_transcript_174856
• CDS coordinates: 2-433 (+)
• Peptide sequence: NFSGKMYNVISYGVDENGEINYEELLRLTKKYKPKMIIGGFSAYSGICNWKKMRFIADKADAYFVVDMAHVAGLVAAGIYPNPINYAHVVTSTTHKTLAGPRGGLILAKNGDDILYKKLNLSVFPGAQGGPLMHVIAAKAIAFK
• ORF Type: internal

Annotations of Ll_transcript_174856

• Blastp: Serine hydroxymethyltransferase from Buchnera with 100% of identity
• Blastx: Serine hydroxymethyltransferase from Buchnera with 100% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (BUAP5A_284)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424128.1)
• Pfam: Serine hydroxymethyltransferase (PF00464.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;