Protein coding transcript 265817

• Transcript: Ll_transcript_221761
• CDS coordinates: 130-801 (+)
• Peptide sequence: MFPYNHFDFLDQHPSNLDILSSSLISDGASGSRPAAVSDEEVLLAASHPKKRAGRKKFKETRHPVYRGVRRRNSGKWVCEVREPNKKTRIWLGTFPTAEMAARAHDVAAIALRGKSACLNFADSAWRLPVPATSEAKDIQKAAAEAAKAFGPVADEGRLANEVAVTSAAATMVEEQEEESSTVPEWLRNMVLMSPTHYNVGSEYGCVDVEFDDAEVSLWNYSI*
• ORF Type: complete

Annotations of Ll_transcript_221761

• Blastp: Dehydration-responsive element-binding protein 1C from Arabidopsis with 58.67% of identity
• Blastx: Dehydration-responsive element-binding protein 1D from Arabidopsis with 85.71% of identity
• Eggnog: dehydration-responsive element-binding protein(ENOG410YK37)
• Kegg: Link to kegg annotations (AT4G25470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452833.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;