Transcript | Ll_transcript_269996 |
---|---|
CDS coordinates | 1-393 (+) |
Peptide sequence | LILNPFPEFCVEIVKMPSAYDNVVIEKLKLKGKALDIKANNAIKKKKKKKHRKSSQHFPQTTTSGGEGKGASNDDYLTPFERRFLQQREKVEVERLVKMARMSHRDKIQGFNQYLANLSDHYDIPKVGPG* |
ORF Type | 5prime_partial |
Blastp | Protein FAM32A-like from Danio with 37.31% of identity |
---|---|
Blastx | Protein FAM32A-like from Danio with 37.31% of identity |
Eggnog | family with sequence similarity 32 member A(ENOG41126B2) |
Kegg | Link to kegg annotations (431750) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003603525.2) |
Pfam | Eukaryotic family of unknown function (DUF1754) (PF08555.9) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer