| Transcript | Ll_transcript_164730 |
|---|---|
| CDS coordinates | 1-354 (+) |
| Peptide sequence | NLCSKIRLTQGKGVMPDGTSRFSCNGKTLYHFMGCSTFSEYTVLAEISVAKIDSKAPLDKVCLLGCGVPTGYGAALNTAGVEPGSNCVIWGLGAVGLAVALGCKAAGAKTVIGVDLNS |
| ORF Type | internal |
| Blastp | Alcohol dehydrogenase class-3 from Octopus with 76.27% of identity |
|---|---|
| Blastx | Alcohol dehydrogenase class-3 from Octopus with 76.27% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_003537123.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer