Protein coding transcript 266251

• Transcript: Ll_transcript_97674
• CDS coordinates: 74-472 (+)
• Peptide sequence: MANYHKLDGKVVQELKDIANKLRIHSISSTQVAKSGHPTSCASIAEILSVLFFNTMRYKVSAPRDPSSDRFVLSKGHAAPALYAAWAEAGLFPVSDLNNLRKLGSDLEGHPTPRLNFIDVGTGSLGQGLAIAN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_97674

• Blastp: Transketolase from Pongo with 65.15% of identity
• Blastx: Transketolase from Pongo with 65.15% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (100174016)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013441562.1)
• Pfam: Transketolase, thiamine diphosphate binding domain (PF00456.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;