Protein coding transcript 26642

• Transcript: Ll_transcript_522616
• CDS coordinates: 580-1101 (+)
• Peptide sequence: MEITSIDLLTWKQSMIDYQCYNMYKKRSQINYEVNIQYILCCMQPGAKVNFPIISDPKREIIKQLNMVDPDEKDSIGNLPSRALHIVGPDKKIKLSFLYPATTGRNVDEVLRVVESLQKASKFKVATPANWKPGEKVVISPDVTNEQAKEMFPQGFETKDLPSKKEYLRFVKV*
• ORF Type: complete

Annotations of Ll_transcript_522616

• Blastp: 1-Cys peroxiredoxin from Medicago with 90.7% of identity
• Blastx: 1-Cys peroxiredoxin from Medicago with 90.7% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463244.1)
• Pfam: AhpC/TSA family (PF00578.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;