Transcript | Ll_transcript_86455 |
---|---|
CDS coordinates | 65-817 (+) |
Peptide sequence | MAGLGVKNKGISDKKKMKYESYSTIKSLPKELLVEILAKVASASMLDLCRVKLVCKDFLDASEDDYVYQHASMDKFALVPLPWFINEKESSFLKRCKDSGNSEITYREGIVEYFSSLKIDSGLEKLKKAALQGHVDSKYVYSMLLMCSQEEKERKVGFDLFCSMKTSTCVIKCRKSVKSFIRNMWVNNHVVRSNQECLCHSSTCESRERLKKLSRMSYLMIEYEDDTAFASCQYCHVDYELCLFCKMFET* |
ORF Type | complete |
Blastp | Putative F-box protein At1g67623 from Arabidopsis with 28.21% of identity |
---|---|
Blastx | Putative F-box protein At1g67623 from Arabidopsis with 28.33% of identity |
Eggnog | DNA replication(COG1599) |
Kegg | Link to kegg annotations (AT1G67623) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437862.1) |
Pfam | F-box domain (PF00646.32) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer