Protein coding transcript 266640

• Transcript: Ll_transcript_161345
• CDS coordinates: 31-309 (+)
• Peptide sequence: MTKRTKKVGITGKYGTRYGASLRKQVKKMEITQHARYVCQFCGKNSVKREAVGIWNCRSCRKTTAGGAYTVSTPAAAATRSTIRRLREIAEV*
• ORF Type: complete

Annotations of Ll_transcript_161345

• Blastp: 60S ribosomal protein L43 from Eremothecium with 76.92% of identity
• Blastx: 60S ribosomal protein L43 from Eremothecium with 76.92% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AGOS_AGL310C)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004508976.1)
• Pfam: Ribosomal L37ae protein family (PF01780.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;