Protein coding transcript 266727

• Transcript: Ll_transcript_164830
• CDS coordinates: 25-462 (-)
• Peptide sequence: EFELIPGLQHYACIVGLLGRAGLFKEAVELINNMEIRPDSAVWGALLSACCIQQEVKLGESLAKKLFFLNYKNGGFYVLMSNLYAIVGRWDDVARVRDMMRDNGGDGCSGVSVIQVTSLKDTNNNNTHLSEGYLNTITWHHLCQY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_164830

• Blastp: Pentatricopeptide repeat-containing protein At2g04860 from Arabidopsis with 66.67% of identity
• Blastx: Pentatricopeptide repeat-containing protein At2g04860 from Arabidopsis with 66.67% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT2G04860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437960.1)
• Pfam: PPR repeat (PF01535.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;