Protein coding transcript 266736

• Transcript: Ll_transcript_48023
• CDS coordinates: 2-388 (-)
• Peptide sequence: ENSFLSEPESFFYSYQNSSYLNNVSKIDSMCDNKSSWNNIINSCIESYLRSRICIDSYFLSDSDKNNDSYLSSYICGKGISWSESESASIITSTNDTNDSDLTIRESSNDLDETQKYKHLWVECENCYG
• ORF Type: internal

Annotations of Ll_transcript_48023

• Blastp: Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic from Lotus with 66.92% of identity
• Blastx: Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic from Morus with 58.52% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002248)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (YP_008963610.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;