Protein coding transcript 26674

• Transcript: Ll_transcript_520508
• CDS coordinates: 932-1261 (+)
• Peptide sequence: MGTIHAGDFMRRFCSNLGMNNQAVKAAQESVQKSEEFDIRRSPISIAAAVIYIITQLSDDKKPLKDISLATGVAEGTIRNSYKDLYPHVSKIIPNWYAKEEDLKNLCSP*
• ORF Type: complete

Annotations of Ll_transcript_520508

• Blastp: Transcription initiation factor IIB from Soja with 98.17% of identity
• Blastx: Transcription initiation factor IIB from Soja with 93.18% of identity
• Eggnog: Stabilizes TBP binding to an archaeal box-A promoter. Also responsible for recruiting RNA polymerase II to the pre- initiation complex (DNA-TBP-TFIIB) (By similarity)(COG1405)
• Kegg: Link to kegg annotations (548070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453293.1)
• Pfam: Transcription factor TFIIB repeat (PF00382.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;