Protein coding transcript 26676

• Transcript: Ll_transcript_520512
• CDS coordinates: 225-581 (+)
• Peptide sequence: MSDAFCSDCKRETEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPNRVGGPSNPLLTDGGLSTVIAKPNGGSGEFLSSSLGRWQNRGSNPDRGLIVAFKTIATMSDR*
• ORF Type: complete

Annotations of Ll_transcript_520512

• Blastp: -
• Blastx: Transcription initiation factor IIB-2 from Arabidopsis with 88% of identity
• Eggnog: Stabilizes TBP binding to an archaeal box-A promoter. Also responsible for recruiting RNA polymerase II to the pre- initiation complex (DNA-TBP-TFIIB) (By similarity)(COG1405)
• Kegg: Link to kegg annotations (AT3G10330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453293.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;