Protein coding transcript 266802

• Transcript: Ll_transcript_265547
• CDS coordinates: 2-592 (-)
• Peptide sequence: MENADPNNNQKEDTYAFRSGKIMLISITVMIIVILIMICINLYVRWHRLRMHHRNHLRGSHNHHNGRSQFVFYIDPALTATTRGLEASVIATLPVFTFSPKGEPVECAVCLSEFKDGEAGRVLPKCKHSFHTKCIDMWFQSHSTCPLCRVHVEAPTQSEVVVNVSEPGSSSEMNRTGVGICSSSSFVNLGAETNYDT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_265547

• Blastp: RING-H2 finger protein ATL2 from Arabidopsis with 44.22% of identity
• Blastx: RING-H2 finger protein ATL2 from Arabidopsis with 52.46% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT3G16720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463142.1)
• Pfam: Ring finger domain (PF13639.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;