Protein coding transcript 266956

• Transcript: Ll_transcript_11643
• CDS coordinates: 1-501 (+)
• Peptide sequence: LARTAISLPTQLAARYKIDRKFALCLPSTSQEGAHGDLIIGGGPYYLSPNDDSKFLNYTPLVINRHSTGPIYNNDPSSEYFIRVISIKVDDHVINFNSSLLYNNKKGHGGTKLSTVIPYTKLHTSIYQALVNDFVNKAEVRNIKRVKEVAPFGACFDSSTIGKAITG
• ORF Type: internal

Annotations of Ll_transcript_11643

• Blastp: Basic 7S globulin 2 from Soja with 31.95% of identity
• Blastx: Basic 7S globulin 2 from Soja with 31.95% of identity
• Eggnog: aspartic(ENOG410XNV7)
• Kegg: Link to kegg annotations (547485)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457542.1)
• Pfam: Xylanase inhibitor N-terminal (PF14543.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;