Protein coding transcript 26709

• Transcript: Ll_transcript_521384
• CDS coordinates: 761-1693 (+)
• Peptide sequence: MHEYTMDEEELRRCPGVKDYYALYKVFKKSGPGPKNGEQYGAPFKEEEWVDDDVVDFSINSADCEVPIPNAVIVDNDQLQPLLDDEIVDFIYGMLDDEQHANAGFPLVVAEGSQSTVVDHLSDAKIFPEPSGIFQSNGQHHDVLPSFDFNQAAVNSQLHVSDALEVTSAPNIQIEEFHFCEEDFLEINDLLIGTEPTQSNVENPGENLQFADGLSEFDLYADMFLELGPITQEDFSCASMNSPETIVVSQNYQKQSNPENANITGVEYWMHDEINTPSGADSFVDSFSLPTTGILISSSYSVAQASKFKI*
• ORF Type: complete

Annotations of Ll_transcript_521384

• Blastp: NAC domain-containing protein 16 from Arabidopsis with 39.85% of identity
• Blastx: NAC domain-containing protein 16 from Arabidopsis with 46.67% of identity
• Eggnog: NAC domain containing protein(ENOG410Y9FR)
• Kegg: Link to kegg annotations (AT1G34180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442022.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;