Protein coding transcript 2671

• Transcript: Ll_transcript_470847
• CDS coordinates: 101-619 (+)
• Peptide sequence: MLLLRMWIPSTMFQVLVMLVVMLYGVGGTDHIVGANRGWNPGINYTLWSNNHTFYVGDLISFRYQKNEYNVFEVNQTGYDNCTTEGAVGNWSKGKDFIPLNMAKRYYFICGNGQCFNGMKVSVLVHPLPSPPSPQSSANHSSHNSAAPLAFQSQFHSLLFSSALLCFAWNWV*
• ORF Type: complete

Annotations of Ll_transcript_470847

• Blastp: Lamin-like protein from Arabidopsis with 38.78% of identity
• Blastx: Lamin-like protein from Arabidopsis with 42.39% of identity
• Eggnog: Plastocyanin-like domain(ENOG410ZMPK)
• Kegg: Link to kegg annotations (AT5G15350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447639.1)
• Pfam: Plastocyanin-like domain (PF02298.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;