Protein coding transcript 267131

• Transcript: Ll_transcript_243974
• CDS coordinates: 75-449 (-)
• Peptide sequence: GNCVDAMEDEFFRLTTKEGKLALERDVVDRKRGECLPLMQFEQDPVQILDAMMPLYLNSQILRGLQESLASELAARMNAMSNATENAIELKKNLSMAYNRQRQAKITGELLEIVAGAEALTPID*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_243974

• Blastp: ATP synthase gamma chain 2, chloroplastic from Arabidopsis with 81.67% of identity
• Blastx: ATP synthase gamma chain 2, chloroplastic from Arabidopsis with 81.67% of identity
• Eggnog: Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex (By similarity)(COG0224)
• Kegg: Link to kegg annotations (AT1G15700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417958.1)
• Pfam: ATP synthase (PF00231.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;