Transcript | Ll_transcript_521373 |
---|---|
CDS coordinates | 992-1924 (+) |
Peptide sequence | MHEYTMDEEELRRCPGVKDYYALYKVFKKSGPGPKNGEQYGAPFKEEEWVDDDVVDFSINSADCEVPIPNAVIVDNDQLQPLLDDEIVDFIYGMLDDEQHANAGFPLVVAEGSQSTVVDHLSDAKIFPEPSGIFQSNGQHHDVLPSFDFNQAAVNSQLHVSDALEVTSAPNIQIEEFHFCEEDFLEINDLLIGTEPTQSNVENPGENLQFADGLSEFDLYADMFLELGPITQEDFSCASMNSPETIVVSQNYQKQSNPENANITGVEYWMHDEINTPSGADSFVDSFSLPTTGILISSSYSVAQASKFKI* |
ORF Type | complete |
Blastp | NAC domain-containing protein 16 from Arabidopsis with 39.85% of identity |
---|---|
Blastx | NAC domain-containing protein 17 from Arabidopsis with 43.94% of identity |
Eggnog | NAC domain containing protein(ENOG410Y9FR) |
Kegg | Link to kegg annotations (AT1G34180) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442022.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer