| Transcript | Ll_transcript_470850 |
|---|---|
| CDS coordinates | 1-348 (+) |
| Peptide sequence | KKDTKGSSKQPQKTQKKKEGGSGGKAKKKKWSKGKVRDKLDNQVLFDNATYDKLLKEVPAYKLITPSILSERLKVRGSLARRALTELTKKGLIKLVVKHHSQVIYTRATKTDDPA* |
| ORF Type | 5prime_partial |
| Blastp | 40S ribosomal protein S25 from Spodoptera with 81.74% of identity |
|---|---|
| Blastx | 40S ribosomal protein S25 from Sophophora with 79.73% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (NP_001241406.1) |
| Pfam | S25 ribosomal protein (PF03297.14) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer