Protein coding transcript 267223

• Transcript: Ll_transcript_52413
• CDS coordinates: 3-575 (-)
• Peptide sequence: FDGLVSVDGTYKGPTNKAIKIAAVCGLGLAVMGMLMLAVTIIRWHKRPQGWEKRKTMSSWLIPINSTCKTSLFSIKSSCRSSSTSSSHKSRNGHSPRGPARFFPFSELQQATQNFDERGVIGVGGFGKVYLGTLEDGKKVAIKRGNGSTEQGINEFRTELNMLSQLRHRHLVSLIGFCDENSEMIIVYEYM
• ORF Type: internal

Annotations of Ll_transcript_52413

• Blastp: Probable receptor-like protein kinase At5g61350 from Arabidopsis with 54.46% of identity
• Blastx: Probable receptor-like protein kinase At5g61350 from Arabidopsis with 52.24% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G61350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438485.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;