| Transcript | Ll_transcript_16511 |
|---|---|
| CDS coordinates | 1-309 (-) |
| Peptide sequence | MYQKLLLFLLLCKSQYVILQESCTCCTDTYVIYAPIVINAMHKILSGAEQDCIRMLPSGFVLPPFVPNLLASPLGGSVLDDGSEGSLIVVAFRMLVDNNPITK |
| ORF Type | 3prime_partial |
| Blastp | Homeobox-leucine zipper protein ROC1 from Oryza sativa with 42.86% of identity |
|---|---|
| Blastx | Homeobox-leucine zipper protein HDG2 from Arabidopsis with 45.05% of identity |
| Eggnog | Homeobox-leucine zipper protein(ENOG411107H) |
| Kegg | Link to kegg annotations (4344832) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019451758.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer