Protein coding transcript 267313

• Transcript: Ll_transcript_275717
• CDS coordinates: 2-316 (+)
• Peptide sequence: IRFPFNEDGQMEKSEDCTNYERIFHFSKEKIAKIKSKANEEADTDKISSLQALLTHLWRTTIRNQQLDPEKECSFLVAIDTRGRIDPPLPDSYFGNALVFDDIRT
• ORF Type: internal

Annotations of Ll_transcript_275717

• Blastp: Protein ENHANCED PSEUDOMONAS SUSCEPTIBILTY 1 from Arabidopsis with 42.11% of identity
• Blastx: Uncharacterized acetyltransferase At3g50280 from Arabidopsis with 42.5% of identity
• Eggnog: Transferase family(ENOG411040Y)
• Kegg: Link to kegg annotations (AT5G67160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459819.1)
• Pfam: Transferase family (PF02458.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;