| Transcript | Ll_transcript_41262 |
|---|---|
| CDS coordinates | 3-353 (+) |
| Peptide sequence | QASQTIDVPEKWSGRFWGRRQCSNANGKFVCGNGDCGSGQVACNGAGGAPPVSLAEFTLSGFGSQDFYDVSLVDGYNLPVSIAPQKGGCQSTICPKDVNTVCPQELALKGSDGGIIG |
| ORF Type | internal |
| Blastp | Thaumatin-like protein 1 from Prunus with 58.47% of identity |
|---|---|
| Blastx | Thaumatin-like protein 1 from Prunus with 58.47% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019425007.1) |
| Pfam | Thaumatin family (PF00314.16) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer