Protein coding transcript 26763

• Transcript: Ll_transcript_520889
• CDS coordinates: 800-1378 (+)
• Peptide sequence: MAHELLKQKNLEEQESNAIAVVTQNGKINFHREGKTGESSEGSIEQNKPTTIQPTSNVSDATHNVSTSLQGNFIDTASIPSLFKEFMTKLRLSLKNQSNLSVLLVTIFALIFFMQFSILMLLARPQQIHVSNGVDYMNKMGSGMTRSPSDIAWMEKRIHHLKDEMYMVESRLERMRYEHALLKKQLKDLDLK*
• ORF Type: complete

Annotations of Ll_transcript_520889

• Blastp: Protein VASCULAR ASSOCIATED DEATH 1, chloroplastic from Arabidopsis with 32.46% of identity
• Blastx: Protein VASCULAR ASSOCIATED DEATH 1, chloroplastic from Arabidopsis with 36.27% of identity
• Eggnog: NA(ENOG41100KT)
• Kegg: Link to kegg annotations (AT1G02120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450080.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;