Protein coding transcript 268

• Transcript: Ll_transcript_367124
• CDS coordinates: 133-1287 (+)
• Peptide sequence: MTTKQSLSLTSHARVSIFLCALTLSTSLHGSSEHNHKTMIQDIARKLKMEENELLGTEKKFKNFIVDYGKEYSTKEEYLHRLQIFAKNMVRAAEHQALDPTAVHGVTQFSDLDEVEFEKHYTGMKGGFGLYGFNNGGEAPSLEVEGLPENIDWREKGAVTPVKMQGKCGSCWAFSTTGSVEGANFIATGKLLSLSEQQLVDCDNKCDITEKSSCDNGCNGGLMTNAYNYLIEAGGLEEESSYPYTGQRGQCMFDKEKVAARVTNFTNIPLDESQIAAYLVNHGPLAIGINAIFMQTYIGGVSCPLICSKRRLNHGVLLVGYAAKGFSILRLSNKPYWIIKNSWGEKWGEHGYYKLCRGHGICGMNTMVSAAMVAQAHANNYASY*
• ORF Type: complete

Annotations of Ll_transcript_367124

• Blastp: Probable cysteine protease RD19D from Arabidopsis with 72.32% of identity
• Blastx: Probable cysteine protease RD19D from Arabidopsis with 72.54% of identity
• Eggnog: cathepsin(COG4870)
• Kegg: Link to kegg annotations (AT3G54940)
• CantataDB: Link to cantataDB annotations (CNT0002196)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459601.1)
• Pfam: Cathepsin propeptide inhibitor domain (I29) (PF08246.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;