Transcript | Ll_transcript_521502 |
---|---|
CDS coordinates | 236-544 (+) |
Peptide sequence | MGQSQPKSGLKLSKEEERQRALAAEREKRAAAAERRIAALKIQSSSATTAPSISEPGSGIASDIHCSCCNSSLAGKVPFHRYNYKYCSTSCMHVHREILEDE* |
ORF Type | complete |
Blastp | Ankyrin repeat and zinc finger domain-containing protein 1 from Mus with 44.68% of identity |
---|---|
Blastx | - |
Eggnog | Ankyrin repeat and zinc finger domain containing 1(ENOG410XQAG) |
Kegg | Link to kegg annotations (52231) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413113.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer