| Transcript | Ll_transcript_521486 |
|---|---|
| CDS coordinates | 738-1046 (+) |
| Peptide sequence | MGQSQPKSGLKLSKEEERQRALAAEREKRAAAAERRIAALKIQSSSATTAPSISEPGSGIASDIHCSCCNSSLAGKVPFHRYNYKYCSTSCMHVHREILEDE* |
| ORF Type | complete |
| Blastp | Ankyrin repeat and zinc finger domain-containing protein 1 from Mus with 44.68% of identity |
|---|---|
| Blastx | - |
| Eggnog | Ankyrin repeat and zinc finger domain containing 1(ENOG410XQAG) |
| Kegg | Link to kegg annotations (52231) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019413113.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer