Protein coding transcript 2682

• Transcript: Ll_transcript_470907
• CDS coordinates: 544-1125 (+)
• Peptide sequence: MDKYIAQLIQLAEKLSQLMSENLGLDKNHIKQVFSGSNKGPAVGTKVAKYPQCPHLDLVRGLREHTDAGGIILLLQDDQVPGLQFFKDGKWVEIPPSKNNAIFVNIGDQVEVMSNGLYKSIVHRVMPDKNGSRISIATFYNPNDDAIISPAPRLLYPTNFSFGDYLKLYGNTKFGEKGPRFESMKNIMTKNGH*
• ORF Type: complete

Annotations of Ll_transcript_470907

• Blastp: 1-aminocyclopropane-1-carboxylate oxidase 1 from Arabidopsis with 72.73% of identity
• Blastx: 1-aminocyclopropane-1-carboxylate oxidase 1 from Arabidopsis with 71.65% of identity
• Eggnog: 2OGFe(II) oxygenase(COG3491)
• Kegg: Link to kegg annotations (AT2G19590)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424364.1)
• Pfam: 2OG-Fe(II) oxygenase superfamily (PF03171.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;