Protein coding transcript 2683

• Transcript: Ll_transcript_470908
• CDS coordinates: 36-365 (+)
• Peptide sequence: MEIPVIDFSNLNGDKRGDTMALLHEACEKWGFFVIENHDIDIELMEKVKQLINTYYEENLKEMFYQSEIVKRLEKQQNMSDIDWESAFFIWHHPTSNINQIPNLSKDLW*
• ORF Type: complete

Annotations of Ll_transcript_470908

• Blastp: 1-aminocyclopropane-1-carboxylate oxidase 1 from Arabidopsis with 65.74% of identity
• Blastx: 1-aminocyclopropane-1-carboxylate oxidase 1 from Arabidopsis with 65.14% of identity
• Eggnog: 2OGFe(II) oxygenase(COG3491)
• Kegg: Link to kegg annotations (AT2G19590)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424364.1)
• Pfam: non-haem dioxygenase in morphine synthesis N-terminal (PF14226.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;