Protein coding transcript 26834

• Transcript: Ll_transcript_521013
• CDS coordinates: 119-625 (+)
• Peptide sequence: MSSQFWKPGTEKPRILEDEEGSVIFLSNSLSSSSYSEKQRQRLPVFKYRNAILYLVETHGTTIIVGETGSGKSTQIPQYLIEAGWGHGGRLIGCTQPRRLAVQAVASRVAQEMGVQLGEEVGYTIRFEDVTKSVSISHYIHFFNVNLDSPNIIDNSDTVRFVWHEISL*
• ORF Type: complete

Annotations of Ll_transcript_521013

• Blastp: Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH9 from Arabidopsis with 75% of identity
• Blastx: Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH9 from Arabidopsis with 76.4% of identity
• Eggnog: helicase(COG1643)
• Kegg: Link to kegg annotations (AT4G18465)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004485864.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;