Transcript | Ll_transcript_521015 |
---|---|
CDS coordinates | 1713-2564 (+) |
Peptide sequence | MPNDGIPEIQRSNLVSCVIQLKALGIDNILGFDWPASPSPEAMIRALEVLYSLGVLDDDAKLTSPVGFQVAEIPLDPMIAKMIIASNQFGCSEEIITIAAVLSIQSIWISGRGIQKESDEAKLRFAAAEGDHVTFLNVYKGFLQSSKSSQWCHKNYVNYQAMRKVIEVREQLKRIAHRIGIVLKSCESDMQAVRKAVTSGFFANACSLEPYSHNGMYKTLRGSQEVYIHPSSVLFRVNPKWVIYNSLVSTDRQYMRNVITVDPSWLLEAAPHFYQLQQSNPLF* |
ORF Type | complete |
Blastp | Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH9 from Arabidopsis with 78.85% of identity |
---|---|
Blastx | Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH9 from Arabidopsis with 73.6% of identity |
Eggnog | helicase(COG1643) |
Kegg | Link to kegg annotations (AT4G18465) |
CantataDB | Link to cantataDB annotations (CNT0002241) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440202.1) |
Pfam | Helicase associated domain (HA2) (PF04408.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer