Protein coding transcript 26838

• Transcript: Ll_transcript_521004
• CDS coordinates: 1713-2333 (+)
• Peptide sequence: MPNDGIPEIQRSNLVSCVIQLKALGIDNILGFDWPASPSPEAMIRALEVLYSLGVLDDDAKLTSPVGFQVAEIPLDPMIAKMIIASNQFGCSEEIITIAAVLSIQSIWISGRGIQKESDEAKLRFAAAEGDHVTFLNVYKGFLQSSKSSQWCHKNYVNYQAMVCICFATFNWFSLSFFANSSRNGDLNCRERLLRLENNSKELHIG*
• ORF Type: complete

Annotations of Ll_transcript_521004

• Blastp: Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH9 from Arabidopsis with 81.48% of identity
• Blastx: Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH9 from Arabidopsis with 73.36% of identity
• Eggnog: helicase(COG1643)
• Kegg: Link to kegg annotations (AT4G18465)
• CantataDB: Link to cantataDB annotations (CNT0002241)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440202.1)
• Pfam: Helicase associated domain (HA2) (PF04408.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;