Protein coding transcript 2684

• Transcript: Ll_transcript_428335
• CDS coordinates: 2-490 (+)
• Peptide sequence: ETLSEEVLGKLGAPQKSDVPIITPHELPEADGLLFGFPTRFGMMSAQFKAFLDATGGLWRTQALAGKPAGIFYSTGSQGGGQETTPLTSITQLVHHGLIFVPIGYTFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSELELAQAFHQGKYFAAIAKKLKGSE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_428335

• Blastp: Probable NAD(P)H dehydrogenase (quinone) FQR1-like 1 from Arabidopsis with 86.25% of identity
• Blastx: Probable NAD(P)H dehydrogenase (quinone) FQR1-like 1 from Arabidopsis with 86.25% of identity
• Eggnog: Nadph-dependent fmn reductase(COG0655)
• Kegg: Link to kegg annotations (AT4G27270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419082.1)
• Pfam: Flavodoxin-like fold (PF02525.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;