Protein coding transcript 26843

• Transcript: Ll_transcript_521011
• CDS coordinates: 203-541 (+)
• Peptide sequence: MQSIWISGRGIQKESDEAKLRFAAAEGDHVTFLNVYKGFLQSSKSSQWCHKNYVNYQAMRKVIEVREQLKRIAHRIGIVLKSCESDMQAVRKAVTSGFFANACSLEPYSHNGM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_521011

• Blastp: Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH9 from Arabidopsis with 74.34% of identity
• Blastx: Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH9 from Arabidopsis with 69.92% of identity
• Eggnog: helicase(COG1643)
• Kegg: Link to kegg annotations (AT4G18465)
• CantataDB: Link to cantataDB annotations (CNT0002241)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440202.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;