Protein coding transcript 26848

• Transcript: Ll_transcript_522180
• CDS coordinates: 807-1712 (+)
• Peptide sequence: MLLRLFNSSFLTKTLPNFNLSKSTSMASSAIECSSSCMLVLCGKSNTENEAAKAIKINNTIKLSQSGDFSVVLHSELDKTDMKHSFQVDSFMNSLSTNTFGRFLIWSPQLDTTHDVVSNNFSELPVGTVCVADVQTKGRGRSKNVWESPLGCLMFSFTLQMEDGRVVPLVQYVVSLAITEAVKDICDKNGLPFLDVKIKWPNDIYLNGFKVGGILCTSKYSSKKFNVSAGIGLNVNNEKPTTSLNSVLRELSVEGYQFRREDVLAAFFNKFEKFYELFINQGFQTLEELYYKTWLHRYIES*
• ORF Type: complete

Annotations of Ll_transcript_522180

• Blastp: Biotin--protein ligase 1, chloroplastic from Arabidopsis with 62% of identity
• Blastx: Biotin--protein ligase 1, chloroplastic from Arabidopsis with 66.54% of identity
• Eggnog: Biotin- acetyl-CoA-carboxylase ligase(COG0340)
• Kegg: Link to kegg annotations (AT2G25710)
• CantataDB: Link to cantataDB annotations (CNT0002087)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433158.1)
• Pfam: Biotin/lipoate A/B protein ligase family (PF03099.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;