Transcript | Ll_transcript_361514 |
---|---|
CDS coordinates | 336-719 (+) |
Peptide sequence | MTDSMLHIELRRWADIMVIAPLSANTLSKIEAGLCDNLLTCIVRAWDYSKPMFVAPSMNYLMWENCFTEKQTISIDELGISLIPPVITRSACGKHVDCAMAEPSSIYSIVRAFYDIKVLKKAPGMVL* |
ORF Type | complete |
Blastp | Phosphopantothenoylcysteine decarboxylase from Arabidopsis with 65.57% of identity |
---|---|
Blastx | Phosphopantothenoylcysteine decarboxylase from Arabidopsis with 65.57% of identity |
Eggnog | Phosphopantothenoylcysteine decarboxylase(COG0452) |
Kegg | Link to kegg annotations (AT3G18030) |
CantataDB | Link to cantataDB annotations (CNT0000942) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019465257.1) |
Pfam | Flavoprotein (PF02441.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer