Protein coding transcript 2694

• Transcript: Ll_transcript_361515
• CDS coordinates: 101-748 (+)
• Peptide sequence: MANSASNPATAKRKAMCEPIAQRKPRILIAACGCVTAVKFQHICHCFSCWAEVKAVVTRASMRFIDRLSMPIGIPVYTDDHEWGTWEKLGDSMLHIELRRWADIMVIAPLSANTLSKIEAGLCDNLLTCIVRAWDYSKPMFVAPSMNYLMWENCFTEKQTISIDELGISLIPPVITRSACGKHVDCAMAEPSSIYSIVRAFYDIKVLKKAPGMVL*
• ORF Type: complete

Annotations of Ll_transcript_361515

• Blastp: Phosphopantothenoylcysteine decarboxylase from Arabidopsis with 60% of identity
• Blastx: Phosphopantothenoylcysteine decarboxylase from Arabidopsis with 60% of identity
• Eggnog: Phosphopantothenoylcysteine decarboxylase(COG0452)
• Kegg: Link to kegg annotations (AT3G18030)
• CantataDB: Link to cantataDB annotations (CNT0000942)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465257.1)
• Pfam: Flavoprotein (PF02441.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;