| Transcript | Ll_transcript_361485 |
|---|---|
| CDS coordinates | 389-718 (+) |
| Peptide sequence | MSDIEKNKRNMATLGGSRVVEGSQNSVEIENLARFAVQEHNKKQNTVLEFVKVISAKAQVVSGTLYDITLEAIDGGNTKVYETKVLEKLWLNFKEVQEFNLVVPTASTT* |
| ORF Type | complete |
| Blastp | Cysteine proteinase inhibitor from Vigna with 71.74% of identity |
|---|---|
| Blastx | Cysteine proteinase inhibitor from Vigna with 71.74% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019456023.1) |
| Pfam | Cystatin domain (PF00031.20) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer