Transcript | Ll_transcript_522256 |
---|---|
CDS coordinates | 110-970 (+) |
Peptide sequence | MSRHSSRTIYVGNLPGDIREREVEDLFFKYGHIAHIDLKVPPRPPGYAFVEFEDPQDAEDAIRGRDGYDFDGHRLRVELAHGGRGNTSSRDRYDSRSNGRGGGGRGGGISKRSDYRVLVTGLPSSASWQDLKDHMRKAGDVCFSQVFRDGRGTTGIVDYTNYDDMKYAIKKLDDSEFKNAFSRGYVHVREYDSRKDSRSPSRDRSYSRGRSYSRSRSRSYSPGHSRSKSPKGKSSRSKSPKGKSSRSKSPKSKPSRLSPAKSPPRSASHSRSRSRSRSLSRYKFLF* |
ORF Type | complete |
Blastp | Serine/arginine-rich-splicing factor SR34 from Arabidopsis with 75% of identity |
---|---|
Blastx | Serine/arginine-rich-splicing factor SR34 from Arabidopsis with 73.85% of identity |
Eggnog | Rna-binding protein(COG0724) |
Kegg | Link to kegg annotations (AT1G02840) |
CantataDB | Link to cantataDB annotations (CNT0000194) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453086.1) |
Pfam | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer