Protein coding transcript 27035

• Transcript: Ll_transcript_522243
• CDS coordinates: 1-567 (+)
• Peptide sequence: DGYDFDGHRLRVELAHGGRGNSSSRGDRYNSRSNGRGEGGRGGGISKRSDYRVLVTGLPSSASWQDLKDHMRKAGDVCFSQVFRDGRGTTGIVDYTNYDDMKYAIKKLDDSEFKNAFSRGYVHVREYDSRKDSRSPSRDRSHSRGRSYSRSRSRSYSPGHNRSKSPKGKSSRSKSPKGKSSRSKSPKGK
• ORF Type: internal

Annotations of Ll_transcript_522243

• Blastp: Serine/arginine-rich-splicing factor SR34 from Arabidopsis with 70.5% of identity
• Blastx: Serine/arginine-rich-splicing factor SR34 from Arabidopsis with 69.47% of identity
• Eggnog: Rna-binding protein(COG0724)
• Kegg: Link to kegg annotations (AT1G02840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428256.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;