Protein coding transcript 27083

• Transcript: Ll_transcript_433767
• CDS coordinates: 133-903 (+)
• Peptide sequence: MLKPSFHYLNSLPSSHSSTSNLISIRFRRTAKISMSMSTSHDTVPPENRVVVGFGMTTVDFLATVDGFPNPDDKVRTTSFKVQGGGNAGNAITCAARLGLKPKLISKVADDSQGTDILNELQADGVDTSFIVVSKGGSSTFSYVLIDNQTKTRTSIYTPGEPPMVPDDLSQSTLLSAFDEARLVYFDGMSTETALFVAQEAARNNIPILVEAESPREGLDELLKLADYAVCSARFPQVVFLLCNSFISLCFSLHAC*
• ORF Type: complete

Annotations of Ll_transcript_433767

• Blastp: Ketohexokinase from Homo with 24.34% of identity
• Blastx: Ribokinase from Bacillus with 28.25% of identity
• Eggnog: Ketohexokinase(ENOG4111F4Q)
• Kegg: Link to kegg annotations (3795)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444452.1)
• Pfam: pfkB family carbohydrate kinase (PF00294.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;