Protein coding transcript 27094

• Transcript: Ll_transcript_433769
• CDS coordinates: 234-737 (+)
• Peptide sequence: MQRLMGRFLQVGFGMTTVDFLATVDGFPNPDDKVRTTSFKVQGGGNAGNAITCAARLGLKPKLISKVADDSQGTDILNELQADGVDTSFIVVSKGGSSTFSYVLIDNQTKTRTSIYTPGEPPMVPDDLSQSTLLSAFDEARLVYFDGMSTETALFVAQEVITILLLL*
• ORF Type: complete

Annotations of Ll_transcript_433769

• Blastp: Ribokinase from Leishmania with 27.62% of identity
• Blastx: Ribokinase from Leishmania with 27.62% of identity
• Eggnog: pfkb domain protein(COG0524)
• Kegg: Link to kegg annotations (LMJF_27_0420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444453.1)
• Pfam: pfkB family carbohydrate kinase (PF00294.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;